Skip to main content

Advertisement

Table 3 Peptides used in this study

From: Binding determinants in the interplay between porcine aminopeptidase N and enterotoxigenic Escherichia coli F4 fimbriae

Peptides Sequences
APN 28–43 FITC-Ahx-ALSVVYAQEKNKNAEH
APN 52–70 FITC-Ahx-TITTTAAITLDQSKPWNRY
APN 133–148 FITC-Ahx-VLRGVGDSQVPEIDRT
APN 208–223 FITC-Ahx-QSTDARKSFPCFDEPA
APN 226–244 FITC-Ahx-ATFNITLIHPNNLTALSNM
APN 367–391 FITC-Ahx-QSSSISNKERVVTVIAHELAHQWFG
APN 436–457 FITC-Ahx-YRVMAVDALASSHPLTTPAEEV
APN 469–493 FITC-Ahx-SISYSKGASVIRMLSNFLTEDLFKE
APN 553–568 FITC-Ahx-KTGNISQKHFLLDSES
APN 580–598 FITC-Ahx-WIVPISSIKNGVMQDHYWL
APN 652–670 FITC-Ahx-VINRAQVIYDSFNLATAHM
APN 841–874 FITC-Ahx-YLGYTLNPDLIRKQDATSTINSIASNVIGQPLAW
APN 901–916 FITC-Ahx-GVTRRFSSEFELQQLE
F4ab 148–160 FITC-Ahx-NASYAGVFGKGGV
F4ab 175–187 FITC-Ahx-LRAIFYGGLTTTV
F4ab 199–217 FITC-Ahx-AARTELFGSLSRNDILGQI
F4ac 149–161 FITC-Ahx-NASYAGVLGRGGV
F4ac 176–188 FITC-Ahx-LSSIFYGGLPRGS
F4ac 200–218 FITC-Ahx-TKLFGSLSRNDILGQIQRV
F4ad 149–161 FITC-Ahx-ASYAGALGRGGVT
F4ad 176–188 FITC-Ahx-HAIFYGGLPTNVK
F4ad 200–218 FITC-Ahx-ARTELFGSLSKNDILGQIQ
F4ab 148–160M FITC-Ahx-NASYAGVFGKGAV
F4ac 200–218 M1 FITC-Ahx-TALFGSLSRNDILGQIQRV
F4ac 200–218 M2 FITC-Ahx-TKAFGSLSRNDILGQIQRV
F4ac 200–218 M3 FITC-Ahx-TKLFASLSRNDILGQIQRV
F4ac 200–218 M4 FITC-Ahx-TKLFGSASRNDILGQIQRV
F4ac 200–218 M5 FITC-Ahx-TKLFGSLARNDILGQIQRV
F4ac 200–218 M6 FITC-Ahx-TKLFGSLSRADILGQIQRV
F4ac 200–218 M7 FITC-Ahx-TKLFGSLSRNDIAGQIQRV
F4ac 200–218 M8 FITC-Ahx-TKLFGSLSRNDILAQIQRV
F4ac 200–218 M9 FITC-Ahx-TKLFGSLSRNDILGQIQAV
F4ad 200–218M FITC-Ahx-ERTELFGSLSKNDILGQIQ
  1. The point-mutant amino acid in FaeG peptides are marked in italic.