Skip to main content

Table 1 The nuclear localization signals (NLSs) of circovirus Cap from different species

From: The serine-48 residue of nucleolar phosphoprotein nucleophosmin-1 plays critical role in subcellular localization and interaction with porcine circovirus type 3 capsid protein

Circoviruses Accession No Sequences of NLSs
PCV1 AY193712.1 MTWPRRRYRRRRTRPRSHLGNILRRRPYLAHPAFRNRYRWRRK
PCV2 AY188355.1 MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRK
PCV3 KT869077.1 MRHRAIFRRRPRPRRRRRHRRRYARRRLFIRRPT
PCV4 MK986820.1 MPIRSRYSRRRRNRRNQRRRGLWPRANRRRYRWRRKN
CanaryCV AJ301633.2 MWLTFNQVARRRRPLAPRRRRWRRRYWXRRRRIPANRR
CanineCV MK731981.1 MRVRRHARASRRRYRTRPLIRYRRRRQNNFKLFHLRLRR
MinkCV MK561562.1 MPVRSRYSRRRRWRRNRRRRGPQRRYARGGYRWRR
DragonflyCV HQ638058.1 MVRYRRAARRPVRRARRSRVRKLRFRRRRRYHRR
CoCV HQ401281.1 MRRRRFYRRRRAPIRRRRIRRRRTRLSRMRRGHR
BtCV JF938082.1 MARFRRRVARRRPVRSIRRIRRRRRYGRRR
DuCV EF370476.1 MRRSTYRRAYRARRRRRGLRRRLRRRRLRIGRPRRR
GoCV AF536940.1 MPLYRARPRSLYYRRRRAANRRRRYRRRRLHIGRIR
BFDV AY450445.1 MNCACAIFQIRRRRYARPYYRRRHNRRYRRRRRYFRRRR